PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c6_24650V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 432aa    MW: 46747.7 Da    PI: 5.2496
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c6_24650V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.27e-172873147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                       +g+W++eEd  l ++v+++G ++W++Iar ++ gR++k+c++rw + 
  Pp3c6_24650V3.1.p 28 KGPWSPEEDVVLNRLVEKFGARNWSLIARGIP-GRSGKSCRLRWCNQ 73
                       79******************************.***********985 PP

2Myb_DNA-binding58.91.1e-1880124147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        r+++T+eEd  +v a++ +G++ W++Iar+++ gRt++ +k++w++ 
  Pp3c6_24650V3.1.p  80 RKPFTEEEDRAIVAAHAIHGNK-WASIARMLP-GRTDNAIKNHWNST 124
                        789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.7522374IPR017930Myb domain
SuperFamilySSF466895.03E-3126121IPR009057Homeodomain-like
SMARTSM007171.2E-142776IPR001005SANT/Myb domain
PfamPF002493.7E-162873IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.8E-262981IPR009057Homeodomain-like
CDDcd001676.96E-143072No hitNo description
PROSITE profilePS5129428.0675129IPR017930Myb domain
SMARTSM007175.3E-1879127IPR001005SANT/Myb domain
PfamPF002496.1E-1680124IPR001005SANT/Myb domain
CDDcd001679.83E-1482125No hitNo description
Gene3DG3DSA:1.10.10.604.3E-2482128IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
MNGAPEGSGG TMRLKGVAGG AGTDDRIKGP WSPEEDVVLN RLVEKFGARN WSLIARGIPG  60
RSGKSCRLRW CNQLNPGVKR KPFTEEEDRA IVAAHAIHGN KWASIARMLP GRTDNAIKNH  120
WNSTLRRKHT GDDRGRKEGS SDGSEKGKED GSDTERIPPA REYDNDAGDD SGRDYDGEEF  180
AVSSDTPNSW PSRNSEKMTA GESMDERSHL RFDQSERDSE NDAQAQAGLK SSEEKPIRPT  240
PRPSAFFSYR KMVGNQGFVE VGSSSVSPPS HANDDGLSST SVSSFMPPFA TWSMPEAPGN  300
CGRGCCPPQS CDRPPETSIS PRGPLMGPDY VESADDGFPT NLPILSSMDD SFASLSDPGA  360
TSKLLSSIHA AVAEIVVPVL QRQMKQTTES FLVVDKESMS SSRLNLGLMR EVVAQEISRY  420
TGILVLDQSP Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-41221281107B-MYB
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.33850.0gametophore
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S53_216V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.16e-59myb domain protein 109